PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G269900.1.p
Common NameSb04g030770, SORBIDRAFT_04g030770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRF
Protein Properties Length: 407aa    MW: 43085 Da    PI: 7.5304
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G269900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.99.8e-25123167145
                   WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                           d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Sobic.004G269900.1.p 123 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVET 167
                           79****************************************997 PP

2QLQ60.83.9e-216095237
                   QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                          +FT+aQ ++L++Q+l+yKyL+a++PvPp+L+++i++
  Sobic.004G269900.1.p 60 PFTPAQYEELEQQALIYKYLVAGVPVPPDLVVPIRR 95
                          9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.1E-125995IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.2E-156094IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.9496095IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.486123167IPR014977WRC domain
PfamPF088794.2E-21124166IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MAMPYASLSP AGADHRSSTA TAASLLPFCR STPLSAGGGG GLGEDAQLSS RWPAARPVVP  60
FTPAQYEELE QQALIYKYLV AGVPVPPDLV VPIRRGLDSL ATRFYGHPTL GGYGTYYLGK  120
KLDPEPGRCR RTDGKKWRCS KEAAPDSKYC ERHMHRGRNR SRKPVETQLV PQSQPPATAA  180
AVSAAPPLAL AAATTTTNGS CFQNHSLYPA IAGSTGGGGG ASNISTPFSS SMGSSQLHMD  240
NAASYAALGG GTAKDLRYNA YGIRSLAEEH NQLIAEAIDS SMENQWRLPP SQTSSFPLSS  300
YPQLGALSNL GQSTVTSLSK MERQQPLSFL GNSEFGAMES AAKQQENQTL RPFFDEWPKA  360
RDSWPGLSDD NAASLAPSFP ATQLSMSIPM ASSDFSVASS QSPNDD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279720.0KJ727972.1 Zea mays clone pUT6086 GRF transcription factor (GRF6) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452692.10.0hypothetical protein SORBIDRAFT_04g030770
SwissprotQ6ZIK50.0GRF4_ORYSJ; Growth-regulating factor 4
TrEMBLC5Y0D70.0C5Y0D7_SORBI; Putative uncharacterized protein Sb04g030770
STRINGSb04g030770.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-42growth-regulating factor 5